PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00259.1.g00250.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 306aa    MW: 33603.8 Da    PI: 4.7601
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00259.1.g00250.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.99.6e-2064117356
                                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                     k++++ +eq+++Le++Fe +++++ ++++ +A+ lgL+ rqV vWFqNrRa++k
  Zpz_sc00259.1.g00250.1.sm.mkhc  64 KKRRLAQEQVRALERCFETDNKLDPDRKACIARDLGLQPRQVAVWFQNRRARWK 117
                                     456899***********************************************9 PP

2HD-ZIP_I/II127.65.3e-4163155193
                     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeener 79 
                                     ekkrrl++eqv++LE++Fe+++kL+p+rK+ +ar+LglqprqvavWFqnrRAR+ktk+lE+d++aL++++dal+++ ++
  Zpz_sc00259.1.g00250.1.sm.mkhc  63 EKKRRLAQEQVRALERCFETDNKLDPDRKACIARDLGLQPRQVAVWFQNRRARWKTKHLERDFAALRARHDALRADCDA 141
                                     69***************************************************************************** PP

                     HD-ZIP_I/II  80 LekeveeLreelke 93 
                                     L++++++L++e++e
  Zpz_sc00259.1.g00250.1.sm.mkhc 142 LRRDKDALAAEIRE 155
                                     *********99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.25E-1856120IPR009057Homeodomain-like
SMARTSM003892.8E-1862123IPR001356Homeobox domain
PROSITE profilePS5007116.11563119IPR001356Homeobox domain
PfamPF000466.0E-1764117IPR001356Homeobox domain
CDDcd000864.01E-1664120No hitNo description
Gene3DG3DSA:1.10.10.605.1E-2070118IPR009057Homeodomain-like
PROSITE patternPS00027094117IPR017970Homeobox, conserved site
PfamPF021833.2E-14119160IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MKRQSKQRLT SSHESTGTGE DLAFAEEENL TARNMEREET EMEDVDEDDD EPARGRSTCG  60
LGEKKRRLAQ EQVRALERCF ETDNKLDPDR KACIARDLGL QPRQVAVWFQ NRRARWKTKH  120
LERDFAALRA RHDALRADCD ALRRDKDALA AEIRELRQKL SNPEPTVKVE ATGNDAAEDR  180
QGTVGASARA VYKDGSSDSD SSVVFNDVEA SPYSGAVFEQ PPQSGGFVGF GGSLIDSAAA  240
TMACSFLPPF GTNWHHGSAT YPCHPYKGGG DSFGLTEEWL AGSDVISSDG VAGFFADDHA  300
SSFNFS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9647501e-147EU964750.1 Zea mays clone 281337 homeodomain-leucine zipper transcription factor TaHDZipI-1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465732.11e-124hypothetical protein SORBIDRAFT_01g044620
SwissprotQ10QP34e-90HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A0A9PIJ11e-137A0A0A9PIJ1_ARUDO; Uncharacterized protein
STRINGSb01g044620.11e-123(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.29e-27homeobox protein 5